View the content of a FASTA file using the FASTA Viewer (SPMF documentation)

SPMF provides a FASTA Viewer Tool to view the content of a FASTA file from the graphical user interface of SPMF. The viewer supports files with the extensions .fasta, .fa, .fna, and .ffn.

This webpage explains how to use this tool with an example.

How to run this example?

If you want to run this example from the graphical interface of SPMF, (1) choose the "Open_FASTA_file_with_viewer" algorithm, (2) choose the FastaDouble.fasta file as input, and then (3) click "run algorithm".

FASTA viewer open dialog

What is a FASTA file?

The FASTA format is a widely used text-based format for representing nucleotide or peptide sequences in bioinformatics. Each entry in a FASTA file consists of:

Example of a FASTA file:

>SEQUENCE_1
MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG
LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK
IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTLAAAACGAAAACG
MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL
>SEQUENCE_2
SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI
ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH
        

What will be displayed?

After running the example, the FASTA Viewer window will open and display the content of the file. The viewer offers two complementary views:

FASTA viewer main window

Features of the FASTA Viewer

Viewing and Navigation

Search and Filter

Export

Analysis Tools

Bioinformatics Tools

Above is a description of version 1.0 of the FASTA Viewer included in SPMF. More features may be added in future versions.